CEBPE Polyclonal AntibodyCEBPE Polyclonal Antibody
Move your mouse over image or click to enlarge

CEBPE Polyclonal Antibody

Cat# Size Price Qty Buy
A13960-200ul 200ul
£332.50
A13960-100ul 100ul
£192.50
A13960-50ul 50ul
£113.75
A13960-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13960
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CEBPE; C/EBP-epsilon; CRP1; CCAAT/enhancer-binding protein epsilon
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CEBPE (NP_001796.2).
Reactivity Human, Mouse, Rat
Gene ID 1053
Calculated MW 30kDa
Observed MW 30-35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents