CD55 Polyclonal AntibodyCD55 Polyclonal Antibody
Move your mouse over image or click to enlarge

CD55 Polyclonal Antibody

Cat# Size Price Qty Buy
A13918-200ul 200ul
£332.50
A13918-100ul 100ul
£192.50
A13918-50ul 50ul
£113.75
A13918-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13918
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD55; CR; CROM; DAF; TC; CD55 molecule (Cromer blood group)
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human CD55 (NP_000565.1).
Reactivity Human, Mouse
Gene ID 1604
Calculated MW 39kDa/41kDa/48kDa/56kDa/59kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents