CD34 Polyclonal AntibodyCD34 Polyclonal Antibody
Move your mouse over image or click to enlarge

CD34 Polyclonal Antibody

Cat# Size Price Qty Buy
A13929-200ul 200ul
£332.50
A13929-100ul 100ul
£192.50
A13929-50ul 50ul
£113.75
A13929-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13929
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD34; CD34 molecule
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CD34 (NP_001020280.1).
Reactivity Human, Mouse, Rat
Gene ID 947
Calculated MW 35kDa/40kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents