THAP2 Polyclonal AntibodyTHAP2 Polyclonal Antibody
Move your mouse over image or click to enlarge

THAP2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3518-200ul 200ul
£332.50
A3518-100ul 100ul
£192.50
A3518-50ul 50ul
£113.75
A3518-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3518
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names THAP2; THAP domain containing 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 83-228 of human THAP2 (NP_113623.1).
Reactivity Mouse, Rat
Gene ID 83591
Calculated MW 26kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents