SOD2 Polyclonal AntibodySOD2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SOD2 Polyclonal Antibody

Cat# Size Price Qty Buy
A1340-200ul 200ul
£332.50
A1340-100ul 100ul
£192.50
A1340-50ul 50ul
£113.75
A1340-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1340
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SOD2; IPO-B; IPOB; MNSOD; MVCD6; Mn-SOD; superoxide dismutase 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-222 of human SOD2 (NP_000627.2).
Reactivity Human, Mouse, Rat
Gene ID 6648
Calculated MW 18kDa/19kDa/20kDa/24kDa
Observed MW 23kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 26159917|28583467|24255720|26903296|28123944|28066264|26603550|25771181
Sequence KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:10 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents