RBFOX3 Polyclonal AntibodyRBFOX3 Polyclonal Antibody
Move your mouse over image or click to enlarge

RBFOX3 Polyclonal Antibody

Cat# Size Price Qty Buy
A15959-20ul 20ul
£77.00
A15959-50ul 50ul
£113.75
A15959-100ul 100ul
£192.50
A15959-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15959
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBFOX3; FOX-3; FOX3; HRNBP3; NEUN; RNA binding protein fox-1 homolog 3
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human RBFOX3 (NP_001076045.1).
Reactivity Human, Mouse, Rat
Gene ID 146713
Calculated MW 33kDa/35kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents