RBBP4 Polyclonal AntibodyRBBP4 Polyclonal Antibody
Move your mouse over image or click to enlarge

RBBP4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13934-200ul 200ul
£332.50
A13934-100ul 100ul
£192.50
A13934-50ul 50ul
£113.75
A13934-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13934
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBBP4; NURF55; RBAP48; lin-53; histone-binding protein RBBP4
Applications ChIP, IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-425 of human RBBP4 (NP_005601.1).
Reactivity Human
Gene ID 5928
Calculated MW 43kDa/46kDa/47kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200|ChIP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents