PRKAA2 Polyclonal AntibodyPRKAA2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PRKAA2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14052-200ul 200ul
£332.50
A14052-100ul 100ul
£192.50
A14052-50ul 50ul
£113.75
A14052-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14052
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PRKAA2; AMPK; AMPK2; AMPKa2; PRKAA; protein kinase AMP-activated catalytic subunit alpha 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 343-552 of human PRKAA2 (NP_006243.2).
Reactivity Human, Mouse
Gene ID 5563
Calculated MW 62kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence ASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents