NPPA Polyclonal AntibodyNPPA Polyclonal Antibody
Move your mouse over image or click to enlarge

NPPA Polyclonal Antibody

Cat# Size Price Qty Buy
A1609-20ul 20ul
£77.00
A1609-50ul 50ul
£113.75
A1609-100ul 100ul
£192.50
A1609-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1609
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NPPA; ANF; ANP; ATFB6; ATRST2; CDD; CDD-ANF; CDP; PND; natriuretic peptide A
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human NPPA (NP_006163.1).
Reactivity Human, Mouse
Gene ID 4878
Calculated MW 16kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 29891648
Sequence NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Sensitivity WB,1:500 - 1:2000|IF,1:10 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents