NF2 Polyclonal AntibodyNF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13626-200ul 200ul
£332.50
A13626-100ul 100ul
£192.50
A13626-50ul 50ul
£113.75
A13626-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13626
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NF2; ACN; BANF; SCH; merlin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2 (NP_000259.1).
Reactivity Human, Mouse, Rat
Gene ID 4771
Calculated MW 19-30kDa/59-72kDa
Observed MW 80kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30844312
Sequence TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents