Mouse Monoclonal to Myelin Basic Protein, MBP
Products
Specifications
| Manufacturer Cat# | MCA-7D2 |
|---|---|
| HGNC Name | MBP |
| RRID | AB_2140350 |
| Molecular Weight | 18.5 and 21.5kDa human isotypes |
| Immunogen | Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. |
| Isotype | IgG1 |
| Purity | Purified antibody at 1mg/mL in 50% PBS, 50% glycerol plus 5mM NaN3 |
| Species | Hu, Rt, Ms, Co, Pi, Ho |
| Applications | IF/ICC, IHC, WB |
| Suggestions For Use | WB: 1:5,000-1:10,000. IF/ICC: 1:2,000-5,000. IHC: 1:10,000 |
| Storage | Store at 4°C for short term, for longer term store at -20°C |