Mouse monoclonal antibody to S-tag peptide from bovine pancreatic RNase A
Mouse monoclonal antibody to S-tag peptide from bovine pancreatic RNase A (MCA-1B63)
Products
Specifications
| Manufacturer Cat# | MCA-1B63 |
|---|---|
| HGNC Name | NA |
| RRID | AB_2923481 |
| Molecular Weight | Not applicable |
| Immunogen | Peptide derived from the N-terminal sequence of pET30a(+), MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFC |
| Isotype | IgG1 |
| Purity | Purified antibody at 1mg/mL in 50% PBS, 50% glycerol plus 5mM NaN3 |
| Species | Co |
| Applications | ICC/IF, WB |
| Suggestions For Use | WB: 1:2,000-1:5,000. ICC/IF: not applicable |
| Storage | Shipped on ice. Store at 4°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles. |