Mouse monoclonal antibody to S-peptide
Products
Specifications
| Manufacturer Cat# | MCA-3H25 |
|---|---|
| HGNC Name | NA |
| RRID | AB_2923482 |
| Molecular Weight | Not applicable |
| Immunogen | Peptide derived from the N-terminal sequence of pET30a(+), MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFC |
| Isotype | IgG1 |
| Purity | Purified antibody at 1mg/mL in 50% PBS, 50% glycerol plus 5mM NaN3 |
| Species | Co |
| Applications | WB |
| Suggestions For Use | WB: 1:2,000-1:5,000 |
| Storage | Shipped on ice. Store at 4°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles. |