MCAM Polyclonal AntibodyMCAM Polyclonal Antibody
Move your mouse over image or click to enlarge

MCAM Polyclonal Antibody

Cat# Size Price Qty Buy
A13927-200ul 200ul
£332.50
A13927-100ul 100ul
£192.50
A13927-50ul 50ul
£113.75
A13927-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13927
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MCAM; CD146; MUC18; cell surface glycoprotein MUC18
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 447-646 of human MCAM (NP_006491.2).
Reactivity Human, Mouse, Rat
Gene ID 4162
Calculated MW 57kDa/71kDa
Observed MW 120kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents