MAF Polyclonal AntibodyMAF Polyclonal Antibody
Move your mouse over image or click to enlarge

MAF Polyclonal Antibody

Cat# Size Price Qty Buy
A3614-200ul 200ul
£332.50
A3614-100ul 100ul
£192.50
A3614-50ul 50ul
£113.75
A3614-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3614
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAF; AYGRP; CCA4; CTRCT21; c-MAF; transcription factor Maf
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human MAF (NP_005351.2).
Reactivity Human, Mouse
Gene ID 4094
Calculated MW 38kDa/41kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Sensitivity WB,1:1000 - 1:3000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents