LRP1 Polyclonal AntibodyLRP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

LRP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A1439-200ul 200ul
£332.50
A1439-100ul 100ul
£192.50
A1439-50ul 50ul
£113.75
A1439-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1439
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LRP1; A2MR; APOER; APR; CD91; IGFBP3R; KPA; LRP; LRP1A; TGFBR5; LDL receptor related protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-270 of human LRP1 (NP_002323.2).
Reactivity Human, Mouse, Rat
Gene ID 4035
Calculated MW 31kDa/504kDa
Observed MW 95kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 26910396
Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDE
Sensitivity WB,1:500 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents