LETM2 Polyclonal AntibodyLETM2 Polyclonal Antibody
Move your mouse over image or click to enlarge

LETM2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13869-200ul 200ul
£332.50
A13869-100ul 100ul
£192.50
A13869-50ul 50ul
£113.75
A13869-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13869
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LETM2; LETM1 domain-containing protein LETM2, mitochondrial
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-396 of human LETM2 (NP_653253.1).
Reactivity Human, Mouse, Rat
Gene ID 137994
Calculated MW 30kDa/44kDa/50kDa/55kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTESKENMVDLAPQLKGTKDEDFIQPPPVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKGA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents