[KO Validated] NUDT1 Polyclonal Antibody[KO Validated] NUDT1 Polyclonal Antibody
Move your mouse over image or click to enlarge

[KO Validated] NUDT1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13330-200ul 200ul
£435.75
A13330-100ul 100ul
£287.00
A13330-50ul 50ul
£173.25
A13330-20ul 20ul
£112.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13330
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NUDT1; MTH1; nudix hydrolase 1
Applications IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human NUDT1 (NP_945192.1).
Reactivity Human
Gene ID 4521
Calculated MW 17kDa/19kDa/20kDa/22kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents