[KO Validated] NDUFB4 Polyclonal Antibody[KO Validated] NDUFB4 Polyclonal Antibody
Move your mouse over image or click to enlarge

[KO Validated] NDUFB4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13820-200ul 200ul
£435.75
A13820-100ul 100ul
£287.00
A13820-50ul 50ul
£173.25
A13820-20ul 20ul
£112.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13820
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NDUFB4; B15; CI-B15; NADH:ubiquinone oxidoreductase subunit B4
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1).
Reactivity Human, Mouse, Rat
Gene ID 4710
Calculated MW 14kDa/15kDa
Observed MW 15kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMG
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents