[KO Validated] GSS Polyclonal Antibody[KO Validated] GSS Polyclonal Antibody
Move your mouse over image or click to enlarge

[KO Validated] GSS Polyclonal Antibody

Cat# Size Price Qty Buy
A14535-200ul 200ul
£435.75
A14535-100ul 100ul
£287.00
A14535-50ul 50ul
£173.25
A14535-20ul 20ul
£112.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14535
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GSS; GSHS; HEL-S-64p; HEL-S-88n; glutathione synthetase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human GSS (NP_000169.1).
Reactivity Human, Mouse, Rat
Gene ID 2937
Calculated MW 40kDa/52kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents