[KO Validated] DPYSL2 Polyclonal Antibody[KO Validated] DPYSL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

[KO Validated] DPYSL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14570-200ul 200ul
£435.75
A14570-100ul 100ul
£287.00
A14570-50ul 50ul
£173.25
A14570-20ul 20ul
£112.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14570
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DPYSL2; CRMP-2; CRMP2; DHPRP2; DRP-2; DRP2; N2A3; ULIP-2; ULIP2; dihydropyrimidinase like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPYSL2 (NP_001377.1).
Reactivity Human
Gene ID 1808
Calculated MW 58kDa/62kDa
Observed MW 62kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents