IL7R Polyclonal AntibodyIL7R Polyclonal Antibody
Move your mouse over image or click to enlarge

IL7R Polyclonal Antibody

Cat# Size Price Qty Buy
A13503-200ul 200ul
£332.50
A13503-100ul 100ul
£192.50
A13503-50ul 50ul
£113.75
A13503-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13503
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IL7R; CD127; CDW127; IL-7R-alpha; IL7RA; ILRA; interleukin 7 receptor
Applications IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human IL7R (NP_002176.2).
Reactivity Human
Gene ID 3575
Calculated MW 28kDa/29kDa/34kDa/51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD
Sensitivity IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents