IFITM1 Polyclonal AntibodyIFITM1 Polyclonal Antibody
Move your mouse over image or click to enlarge

IFITM1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4228-200ul 200ul
£332.50
A4228-100ul 100ul
£192.50
A4228-50ul 50ul
£113.75
A4228-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4228
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IFITM1; 9-27; CD225; DSPA2a; IFI17; LEU13; interferon-induced transmembrane protein 1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human IFITM1 (NP_003632.3).
Reactivity Human, Mouse
Gene ID 8519
Calculated MW 13kDa
Observed MW 17kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 29961753
Sequence CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Sensitivity WB,1:200 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents