HADHA Polyclonal AntibodyHADHA Polyclonal Antibody
Move your mouse over image or click to enlarge

HADHA Polyclonal Antibody

Cat# Size Price Qty Buy
A13310-200ul 200ul
£332.50
A13310-100ul 100ul
£192.50
A13310-50ul 50ul
£113.75
A13310-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13310
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HADHA; ECHA; GBP; HADH; LCEH; LCHAD; MTPA; TP-ALPHA; trifunctional enzyme subunit alpha, mitochondrial
Applications IF, IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 484-763 of human HADHA (NP_000173.2).
Reactivity Human, Mouse
Gene ID 3030
Calculated MW 28kDa/83kDa
Observed MW 83kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200|IP,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents