GLRX3 Polyclonal AntibodyGLRX3 Polyclonal Antibody
Move your mouse over image or click to enlarge

GLRX3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13580-200ul 200ul
£332.50
A13580-100ul 100ul
£192.50
A13580-50ul 50ul
£113.75
A13580-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13580
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GLRX3; GLRX4; GRX3; GRX4; PICOT; TXNL2; TXNL3; glutaredoxin-3
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human GLRX3 (NP_001186797.1).
Reactivity Human, Mouse
Gene ID 10539
Calculated MW 37kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents