EGLN2 Polyclonal AntibodyEGLN2 Polyclonal Antibody
Move your mouse over image or click to enlarge

EGLN2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13447-200ul 200ul
£332.50
A13447-100ul 100ul
£192.50
A13447-50ul 50ul
£113.75
A13447-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13447
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EGLN2; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1; egl nine homolog 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EGLN2 (NP_444274.1).
Reactivity Mouse, Rat
Gene ID 112398
Calculated MW 40kDa/43kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents