DPP4 Polyclonal AntibodyDPP4 Polyclonal Antibody
Move your mouse over image or click to enlarge

DPP4 Polyclonal Antibody

Cat# Size Price Qty Buy
A1455-200ul 200ul
£332.50
A1455-100ul 100ul
£192.50
A1455-50ul 50ul
£113.75
A1455-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1455
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DPP4; ADABP; ADCP2; CD26; DPPIV; TP103; dipeptidyl peptidase 4
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-280 of human DPP4 (NP_001926.2).
Reactivity Human, Mouse, Rat
Gene ID 1803
Calculated MW 88kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVT
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents