CTSG Polyclonal AntibodyCTSG Polyclonal Antibody
Move your mouse over image or click to enlarge

CTSG Polyclonal Antibody

Cat# Size Price Qty Buy
A13172-200ul 200ul
£332.50
A13172-100ul 100ul
£192.50
A13172-50ul 50ul
£113.75
A13172-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13172
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CTSG; CATG; CG; cathepsin G
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 75-190 of human CTSG (NP_001902.1).
Reactivity Human, Mouse, Rat
Gene ID 1511
Calculated MW 28kDa
Observed MW 29kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDR
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents