CTLA4 Polyclonal AntibodyCTLA4 Polyclonal Antibody
Move your mouse over image or click to enlarge

CTLA4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13966-200ul 200ul
£332.50
A13966-100ul 100ul
£192.50
A13966-50ul 50ul
£113.75
A13966-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13966
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CTLA4; ALPS5; CD; CD152; CELIAC3; CTLA-4; GRD4; GSE; IDDM12; cytotoxic T-lymphocyte protein 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 16-66 of human CTLA4 (NP_005205.2).
Reactivity Human
Gene ID 1493
Calculated MW 6kDa/8kDa/19kDa/24kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents