CRTC3 Polyclonal AntibodyCRTC3 Polyclonal Antibody
Move your mouse over image or click to enlarge

CRTC3 Polyclonal Antibody

Cat# Size Price Qty Buy
A15890-20ul 20ul
£77.00
A15890-50ul 50ul
£113.75
A15890-100ul 100ul
£192.50
A15890-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15890
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CRTC3; TORC-3; TORC3; CREB-regulated transcription coactivator 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CRTC3 (NP_073606.3).
Reactivity Human, Mouse
Gene ID 64784
Calculated MW 66kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents