CPNE6 Polyclonal AntibodyCPNE6 Polyclonal Antibody
Move your mouse over image or click to enlarge

CPNE6 Polyclonal Antibody

Cat# Size Price Qty Buy
A14385-200ul 200ul
£332.50
A14385-100ul 100ul
£192.50
A14385-50ul 50ul
£113.75
A14385-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14385
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CPNE6; copine-6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 268-557 of human CPNE6 (NP_006023.1).
Reactivity Mouse, Rat
Gene ID 9362
Calculated MW 61kDa/67kDa
Observed MW 62kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KYRDKKKNYKSSGTVVLAQCTVEKVHTFLDYIMGGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVAEPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLRCPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGISPGAPRPCTLATTPSPSP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents