CLU Polyclonal AntibodyCLU Polyclonal Antibody
Move your mouse over image or click to enlarge

CLU Polyclonal Antibody

Cat# Size Price Qty Buy
A13479-200ul 200ul
£332.50
A13479-100ul 100ul
£192.50
A13479-50ul 50ul
£113.75
A13479-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13479
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CLU; AAG4; APO-J; APOJ; CLI; CLU1; CLU2; KUB1; NA1/NA2; SGP-2; SGP2; SP-40; TRPM-2; TRPM2; clusterin
Applications IF, IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human CLU (NP_976084.1).
Reactivity Human, Mouse, Rat
Gene ID 1191
Calculated MW 32kDa/48kDa/52kDa/53kDa/57kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Sensitivity IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents