CD177 Polyclonal AntibodyCD177 Polyclonal Antibody
Move your mouse over image or click to enlarge

CD177 Polyclonal Antibody

Cat# Size Price Qty Buy
A13597-200ul 200ul
£332.50
A13597-100ul 100ul
£192.50
A13597-50ul 50ul
£113.75
A13597-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13597
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD177; HNA-2a; HNA2A; NB1; NB1 GP; PRV-1; PRV1; NB1GP; CD177 antigen
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-285 of human CD177 (NP_065139.2).
Reactivity Human
Gene ID 57126
Calculated MW 15kDa/27kDa/46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNLLNGTQEIGPVGMTENCDMKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGV
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents