CD164 Polyclonal AntibodyCD164 Polyclonal Antibody
Move your mouse over image or click to enlarge

CD164 Polyclonal Antibody

Cat# Size Price Qty Buy
A13254-200ul 200ul
£332.50
A13254-100ul 100ul
£192.50
A13254-50ul 50ul
£113.75
A13254-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13254
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CD164; DFNA66; MGC-24; MGC-24v; MUC-24; endolyn; CD164 molecule
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-162 of human CD164 (NP_006007.2).
Reactivity Human
Gene ID 8763
Calculated MW 16kDa/19kDa/20kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents