CCT6A Polyclonal AntibodyCCT6A Polyclonal Antibody
Move your mouse over image or click to enlarge

CCT6A Polyclonal Antibody

Cat# Size Price Qty Buy
A3589-200ul 200ul
£332.50
A3589-100ul 100ul
£192.50
A3589-50ul 50ul
£113.75
A3589-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3589
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CCT6A; CCT-zeta; CCT-zeta-1; CCT6; Cctz; HTR3; MoDP-2; TCP-1-zeta; TCP20; TCPZ; TTCP20; T-complex protein 1 subunit zeta
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-250 of human CCT6A (NP_001753.1).
Reactivity Human, Mouse, Rat
Gene ID 908
Calculated MW 53kDa/58kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFY
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents