CCKBR Polyclonal AntibodyCCKBR Polyclonal Antibody
Move your mouse over image or click to enlarge

CCKBR Polyclonal Antibody

Cat# Size Price Qty Buy
A14567-200ul 200ul
£332.50
A14567-100ul 100ul
£192.50
A14567-50ul 50ul
£113.75
A14567-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14567
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CCKBR; CCK-B; CCK2R; GASR; cholecystokinin B receptor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-335 of human CCKBR (NP_795344.1).
Reactivity Human, Mouse, Rat
Gene ID 887
Calculated MW 41kDa/48kDa/55kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRML
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents