CCDC6 Polyclonal AntibodyCCDC6 Polyclonal Antibody
Move your mouse over image or click to enlarge

CCDC6 Polyclonal Antibody

Cat# Size Price Qty Buy
A16075-20ul 20ul
£77.00
A16075-50ul 50ul
£113.75
A16075-100ul 100ul
£192.50
A16075-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16075
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CCDC6; D10S170; H4; PTC; TPC; TST1; coiled-coil domain containing 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2).
Reactivity Human, Mouse
Gene ID 8030
Calculated MW 53kDa
Observed MW 56kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents