CCDC47 Polyclonal AntibodyCCDC47 Polyclonal Antibody
Move your mouse over image or click to enlarge

CCDC47 Polyclonal Antibody

Cat# Size Price Qty Buy
A15871-20ul 20ul
£77.00
A15871-50ul 50ul
£113.75
A15871-100ul 100ul
£192.50
A15871-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15871
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CCDC47; GK001; MSTP041; coiled-coil domain containing 47
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 224-483 of human CCDC47 (NP_064583.2).
Reactivity Human, Mouse, Rat
Gene ID 57003
Calculated MW 55kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents