CC2D1A Polyclonal AntibodyCC2D1A Polyclonal Antibody
Move your mouse over image or click to enlarge

CC2D1A Polyclonal Antibody

Cat# Size Price Qty Buy
A4800-200ul 200ul
£332.50
A4800-100ul 100ul
£192.50
A4800-50ul 50ul
£113.75
A4800-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4800
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CC2D1A; FREUD-1; Freud-1/Aki1; MRT3; coiled-coil and C2 domain containing 1A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3).
Reactivity Human, Mouse, Rat
Gene ID 54862
Calculated MW 103kDa/104kDa
Observed MW 131kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTA
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents