CBS Polyclonal AntibodyCBS Polyclonal Antibody
Move your mouse over image or click to enlarge

CBS Polyclonal Antibody

Cat# Size Price Qty Buy
A1427-200ul 200ul
£332.50
A1427-100ul 100ul
£192.50
A1427-50ul 50ul
£113.75
A1427-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1427
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CBS; HIP4; cystathionine beta-synthase
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 252-551 of human CBS (NP_000062.1).
Reactivity Human, Mouse
Gene ID 875
Calculated MW 60kDa/61kDa
Observed MW 61kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 29298893
Sequence VASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents