CAND1 Polyclonal AntibodyCAND1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CAND1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14287-200ul 200ul
£332.50
A14287-100ul 100ul
£192.50
A14287-50ul 50ul
£113.75
A14287-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14287
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CAND1; TIP120; TIP120A; cullin-associated NEDD8-dissociated protein 1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 750-980 of human CAND1 (NP_060918.2).
Reactivity Human, Mouse, Rat
Gene ID 55832
Calculated MW 45kDa/117kDa/136kDa
Observed MW 136kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSY
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents