CAMK2G Polyclonal AntibodyCAMK2G Polyclonal Antibody
Move your mouse over image or click to enlarge

CAMK2G Polyclonal Antibody

Cat# Size Price Qty Buy
A3231-200ul 200ul
£332.50
A3231-100ul 100ul
£192.50
A3231-50ul 50ul
£113.75
A3231-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3231
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CAMK2G; CAMK; CAMK-II; CAMKG; calcium/calmodulin dependent protein kinase II gamma
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CAMK2G (NP_751909.1).
Reactivity Human, Mouse, Rat
Gene ID 818
Calculated MW 55kDa/58kDa/59kDa/60kDa/61kDa/62kDa/65kDa
Observed MW 75kDa/80kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAI
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents