CACNG2 Polyclonal AntibodyCACNG2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CACNG2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14101-200ul 200ul
£332.50
A14101-100ul 100ul
£192.50
A14101-50ul 50ul
£113.75
A14101-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14101
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CACNG2; MRD10; voltage-dependent calcium channel gamma-2 subunit
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 204-323 of human CACNG2 (NP_006069.1).
Reactivity Human
Gene ID 10369
Calculated MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKENKDSLHSNTANRRTTPV
Sensitivity IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents