CACNB2 Polyclonal AntibodyCACNB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CACNB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16037-20ul 20ul
£77.00
A16037-50ul 50ul
£113.75
A16037-100ul 100ul
£192.50
A16037-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16037
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CACNB2; CACNLB2; CAVB2; MYSB; calcium voltage-gated channel auxiliary subunit beta 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 481-660 of human CACNB2 (NP_963890.2).
Reactivity Human, Mouse, Rat
Gene ID 783
Calculated MW 64kDa/65kDa/68kDa/69kDa/70kDa/71kDa/73kDa
Observed MW 90kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents