CABP7 Polyclonal AntibodyCABP7 Polyclonal Antibody
Move your mouse over image or click to enlarge

CABP7 Polyclonal Antibody

Cat# Size Price Qty Buy
A13703-200ul 200ul
£332.50
A13703-100ul 100ul
£192.50
A13703-50ul 50ul
£113.75
A13703-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13703
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CABP7; CALN2; calcium-binding protein 7
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1).
Reactivity Human, Mouse, Rat
Gene ID 164633
Calculated MW 24kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents