C9orf72 Polyclonal AntibodyC9orf72 Polyclonal Antibody
Move your mouse over image or click to enlarge

C9orf72 Polyclonal Antibody

Cat# Size Price Qty Buy
A15970-20ul 20ul
£77.00
A15970-50ul 50ul
£113.75
A15970-100ul 100ul
£192.50
A15970-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15970
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names C9orf72; ALSFTD; DENNL72; FTDALS; FTDALS1; protein C9orf72
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human C9orf72 (NP_060795.1).
Reactivity Human, Mouse
Gene ID 203228
Calculated MW 24kDa/54kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEIDIADTVLNDDDIGDSCHEGFLLNAISSHLQT
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents