C1QTNF7 Polyclonal AntibodyC1QTNF7 Polyclonal Antibody
Move your mouse over image or click to enlarge

C1QTNF7 Polyclonal Antibody

Cat# Size Price Qty Buy
A16031-20ul 20ul
£77.00
A16031-50ul 50ul
£113.75
A16031-100ul 100ul
£192.50
A16031-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16031
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names C1QTNF7; CTRP7; ZACRP7; C1q and TNF related 7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-190 of human C1QTNF7 (NP_001128642.1).
Reactivity Mouse, Rat
Gene ID 114905
Calculated MW 30kDa/31kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence QPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents