C12orf29 Polyclonal AntibodyC12orf29 Polyclonal Antibody
Move your mouse over image or click to enlarge

C12orf29 Polyclonal Antibody

Cat# Size Price Qty Buy
A15927-20ul 20ul
£77.00
A15927-50ul 50ul
£113.75
A15927-100ul 100ul
£192.50
A15927-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15927
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names C12orf29; uncharacterized protein C12orf29
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human C12orf29 (NP_001009894.2).
Reactivity Human, Mouse
Gene ID 91298
Calculated MW 4kDa/34kDa/37kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNKQYCWHSSVVNYEFEIALVLKHHPDDSGLLEISAVPLSDLLEQTLELIGTNINGNPYGLGSKKHPLHLLIPHGAFQIRNLPSLKHNDLVSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSAFDIKCLFNHFLKIDNQKFVRLKDIIFDV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents