BZW1 Polyclonal AntibodyBZW1 Polyclonal Antibody
Move your mouse over image or click to enlarge

BZW1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3359-200ul 200ul
£332.50
A3359-100ul 100ul
£192.50
A3359-50ul 50ul
£113.75
A3359-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3359
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BZW1; BZAP45; Nbla10236; basic leucine zipper and W2 domains 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human BZW1 (NP_001193996.1).
Reactivity Human, Mouse
Gene ID 9689
Calculated MW 40kDa/48kDa/51kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIPEP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents