BTLA Polyclonal AntibodyBTLA Polyclonal Antibody
Move your mouse over image or click to enlarge

BTLA Polyclonal Antibody

Cat# Size Price Qty Buy
A13449-200ul 200ul
£332.50
A13449-100ul 100ul
£192.50
A13449-50ul 50ul
£113.75
A13449-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13449
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BTLA; BTLA1; CD272; B and T lymphocyte associated
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-241 of human BTLA (NP_001078826.1).
Reactivity Human, Mouse
Gene ID 151888
Calculated MW 27kDa/32kDa
Observed MW 33kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents